DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sos and RASGRP1

DIOPT Version :9

Sequence 1:NP_476597.2 Gene:Sos / 34790 FlyBaseID:FBgn0001965 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_005730.2 Gene:RASGRP1 / 10125 HGNCID:9878 Length:797 Species:Homo sapiens


Alignment Length:496 Identity:105/496 - (21%)
Similarity:187/496 - (37%) Gaps:120/496 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   640 MIKGATLCKLIERLTYHIYADPTFVRT------FLTTYRYFCSPQQLLQLLVERFNIPDPSLVYQ 698
            :.|||:|..||:.......||....|:      .||.:|...|..:|||.::         .:|:
Human    56 LAKGASLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVI---------TLYK 111

  Fly   699 DTGTAGAGGMGGVGGDKEHKNSHREDWKRYRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLE 763
            |.....:.|:                            ..::...:|:|:...:..|:.|..|.:
Human   112 DALAKNSPGL----------------------------CLKICYFVRYWITEFWVMFKMDASLTD 148

  Fly   764 KLLNFLEHVNGK--------------SMRKWVDSVLKIVQRKNEQEKSNKKIVYAYGHDPPPIEH 814
            .:..|.|.|..|              :.|.|   ..|:.||........:|:...:.|       
Human   149 TMEEFQELVKAKGEELHCRLIDTTQINARDW---SRKLTQRIKSNTSKKRKVSLLFDH------- 203

  Fly   815 HLSVPNDEITLLTLHPLELARQLTLLEFEMYKNVKPSE----LVGSPWTKKDKEVK-SPNLLKIM 874
                         |.|.||:..||.|||:.::.:..|:    ||.|.       || :|.:.:.:
Human   204 -------------LEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSC-------VKENPTMERSI 248

  Fly   875 KHTTNVTRWIEKSITEAENYEERLAIMQRAIEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTF 939
            .....:::|::..:......:.|..:..:.|:|...:.:|.|||.:::::..:..:|:.||:.|.
Human   249 ALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETS 313

  Fly   940 QGLPERYRKFLEECREL------SDDHLKKYQERLRSINPPC----VPFFGRYLTNILHLEEGNP 994
            ..:|....|.|.|..||      .|::.:.|.|        |    :|..|.:|.:::.|.|..|
Human   314 SHVPHEINKVLGEMTELLSSSRNYDNYRRAYGE--------CTDFKIPILGVHLKDLISLYEAMP 370

  Fly   995 DLLANTELINFSKRRKVAEIIGEIQQYQN--QPYCLNEESTIRQFFEQLDPFNGLSDKQMSDYLY 1057
            |.|.:.: :|..|...:...|.|:.|.|.  .|...|:: .:......||.:      ...|.:|
Human   371 DYLEDGK-VNVHKLLALYNHISELVQLQEVAPPLEANKD-LVHLLTLSLDLY------YTEDEIY 427

  Fly  1058 NESLRIEPRGCKTVPKFPRKWPHIPLKSPGIKPRRQNQTNS 1098
            ..|...|||..:..|..|.|.|.:...:.|:.|:...:|.|
Human   428 ELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTIS 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SosNP_476597.2 Histone 90..216 CDD:278551
H2A 155..>196 CDD:305064
RhoGEF 249..432 CDD:238091
PH_SOS 476..586 CDD:269963
PH 482..587 CDD:278594
RasGEFN 637..791 CDD:214571 32/170 (19%)
RasGEF 825..1062 CDD:238087 59/253 (23%)
RASGRP1NP_005730.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
RasGEFN 54..175 CDD:214571 28/155 (18%)
Ras exchanger motif region, required for transforming activity. /evidence=ECO:0000250 57..110 16/61 (26%)
RasGEF 201..437 CDD:214539 62/278 (22%)
EF-hand_7 478..527 CDD:372618
C1_1 542..591 CDD:365894
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 673..694
Suppress the PT region-mediated translocation to plasma membrane. /evidence=ECO:0000250 686..694
PT region, mediates the BCR-dependent translocation to plasma membrane. /evidence=ECO:0000250 718..797
bZIP <734..780 CDD:389750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.