DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16865 and AT5G63440

DIOPT Version :9

Sequence 1:NP_001260451.1 Gene:CG16865 / 34788 FlyBaseID:FBgn0028919 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_568972.2 Gene:AT5G63440 / 836463 AraportID:AT5G63440 Length:232 Species:Arabidopsis thaliana


Alignment Length:230 Identity:53/230 - (23%)
Similarity:89/230 - (38%) Gaps:41/230 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKVVSRSIVCSDTKDQEEYNEEKPLNIYYCL-CNKMALILDCTLEQLPLREVDNARVINANDHA 64
            |||   |:.....::|......:..|.:|||. |....||.|..|:::|.|:.|.:.|::...|.
plant     1 MPK---RTTHTYSSEDAAPDGPDSDLFVYYCKHCGSHVLITDTQLQKMPKRKTDRSNVLDKKTHL 62

  Fly    65 NKLTHNPTPRMVYIKRKSRGNG-IEKQYRYKCRSCSLPLYYRHSPD-SHVTFVMSNALIRNKGES 127
            .:|..:...:::.    .||.| :|:|:|..|..|.|.:.||...: ...:|:..          
plant    63 ARLNVSEGGKVLL----KRGEGKMERQFRMNCIGCELFVCYRAEENLETASFIYI---------- 113

  Fly   128 PLTQLLNSEIKGSFKAPAAKPATSAGPDDSGIVDASGKKVVVTRHTKNMGKFSSVTVSTIDEEED 192
                     :.|:..|.||:......|....|....|..|.|....::..:.|::|....|:...
plant   114 ---------VDGALSAVAAETNPQDAPVPPCISQLDGGLVQVAIEVEDRAQRSAITRVNADDVRV 169

  Fly   193 EIEAREIADSYANN-----------ARIIEKQLQR 216
            .: |...|...|||           .|:.:..|||
plant   170 TV-AAPAARGEANNELLEFMGRVLGLRLSQMTLQR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16865NP_001260451.1 None
AT5G63440NP_568972.2 DUF167 144..215 CDD:396929 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4397
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1161089at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104276
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.