DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16865 and Steep1

DIOPT Version :9

Sequence 1:NP_001260451.1 Gene:CG16865 / 34788 FlyBaseID:FBgn0028919 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_006541473.1 Gene:Steep1 / 77644 MGIID:1924894 Length:232 Species:Mus musculus


Alignment Length:232 Identity:110/232 - (47%)
Similarity:146/232 - (62%) Gaps:53/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKVVSRSIVCSDTKDQEEYNE-EKPLNIYYCLCNKMALILDCTLEQLPLREVDNARVINANDHA 64
            ||||||||:|||||:|:|||:: ||||::|||||.:|.|:|||.||:||:|..|.:|||:|..||
Mouse     1 MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHA 65

  Fly    65 NKLTHNPTPRMVYIKRKSRGNGIEKQYRYKCRSCSLPLYYRHSP-DSHVTFVMSNALIR------ 122
            :|..:.......|::|.   .|||:|||.||..|.|||:|:..| ::.|||::..|:::      
Mouse    66 HKFCNTEDEETTYLRRP---EGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFG 127

  Fly   123 ------NKGESPLTQLLNSEIKGSFKAPAAKPATSAGPDDSGIVDASGKKVVVTRHTKNMGKFSS 181
                  .|.|.|                                    |||::|:.||:||||||
Mouse   128 KTNIYTQKQEPP------------------------------------KKVMMTKRTKDMGKFSS 156

  Fly   182 VTVSTIDEEEDEIEAREIADSYANNARIIEKQLQRKG 218
            ||||||||||:||||||:|||||.||::|||||:|||
Mouse   157 VTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKG 193



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833457
Domainoid 1 1.000 205 1.000 Domainoid score I2918
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11133
Inparanoid 1 1.050 206 1.000 Inparanoid score I3716
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49228
OrthoDB 1 1.010 - - D1161089at2759
OrthoFinder 1 1.000 - - FOG0006280
OrthoInspector 1 1.000 - - oto92308
orthoMCL 1 0.900 - - OOG6_104276
Panther 1 1.100 - - LDO PTHR46355
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4156
SonicParanoid 1 1.000 - - X5231
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.