DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16865 and Steep1

DIOPT Version :9

Sequence 1:NP_001260451.1 Gene:CG16865 / 34788 FlyBaseID:FBgn0028919 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001101420.1 Gene:Steep1 / 313433 RGDID:1564541 Length:222 Species:Rattus norvegicus


Alignment Length:266 Identity:116/266 - (43%)
Similarity:160/266 - (60%) Gaps:68/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKVVSRSIVCSDTKDQEEYNE-EKPLNIYYCLCNKMALILDCTLEQLPLREVDNARVINANDHA 64
            ||||||||:|||||:|:|||:: ||||::|||||.:|.|:|||.||:||:|..|.:|||:|..||
  Rat     1 MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHA 65

  Fly    65 NKLTHNPTPRMVYIKRKSRGNGIEKQYRYKCRSCSLPLYYRHSP-DSHVTFVMSNALIR------ 122
            :|..:.......|::|.   .|||:|||.||..|.|||:|:..| ::.|||::..|:::      
  Rat    66 HKFCNTEDEETTYLRRP---EGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFG 127

  Fly   123 ------NKGESPLTQLLNSEIKGSFKAPAAKPATSAGPDDSGIVDASGKKVVVTRHTKNMGKFSS 181
                  .|.|.|                                    |||::|:.||:||||||
  Rat   128 KTNIYTQKQEPP------------------------------------KKVMMTKRTKDMGKFSS 156

  Fly   182 VTVSTIDEEEDEIEAREIADSYANNARIIEKQLQRKG------GKLSDVGIKTKTEDAPPPQKKQ 240
            ||||||||||:||||||:|||||.||::|||||:|||      .:|:::..|         :.|.
  Rat   157 VTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAK---------KAKM 212

  Fly   241 RGTLLE 246
            :|||::
  Rat   213 KGTLID 218



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337014
Domainoid 1 1.000 205 1.000 Domainoid score I2817
eggNOG 1 0.900 - - E1_KOG4397
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11133
Inparanoid 1 1.050 206 1.000 Inparanoid score I3643
OMA 1 1.010 - - QHG49228
OrthoDB 1 1.010 - - D1161089at2759
OrthoFinder 1 1.000 - - FOG0006280
OrthoInspector 1 1.000 - - oto95875
orthoMCL 1 0.900 - - OOG6_104276
Panther 1 1.100 - - LDO PTHR46355
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5231
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.