DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16865 and new20

DIOPT Version :9

Sequence 1:NP_001260451.1 Gene:CG16865 / 34788 FlyBaseID:FBgn0028919 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001343143.1 Gene:new20 / 14217795 PomBaseID:SPBC839.19 Length:115 Species:Schizosaccharomyces pombe


Alignment Length:76 Identity:23/76 - (30%)
Similarity:39/76 - (51%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YYCLCNKMALILDCTLEQLPLREVDNARVINANDHANKLTHNPTPRMVYIKRKSRGNGIEKQYRY 93
            |:|.|.::.|.:..:|.:||.|::|...|:  ::..|.:.|..|....||.|..  .|.|::.:.
pombe    14 YFCPCGQLFLTIHVSLTRLPQRQLDKRHVV--DEKLNHIAHFSTGNKYYITRSD--GGYEQRIQL 74

  Fly    94 KCRSCSLPLYY 104
            .||.|:|...|
pombe    75 LCRRCTLECAY 85



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006280
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104276
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4156
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.