DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adat1 and CG5641

DIOPT Version :9

Sequence 1:NP_001260450.1 Gene:Adat1 / 34787 FlyBaseID:FBgn0028658 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster


Alignment Length:94 Identity:27/94 - (28%)
Similarity:34/94 - (36%) Gaps:33/94 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 EDSEMVYTGAKLISDLSDDPMLQTP-GALRTKPGRGERTLSMSCSDKIARWNVIGVQGALLDVLI 212
            :||.:.....|...|||..|..||. |.|.||                       || |:||.|:
  Fly    49 DDSALTAALLKRNQDLSPTPSEQTAIGNLVTK-----------------------VQ-AVLDNLV 89

  Fly   213 SKPIYFSSLNFCCDDAQLESLER-AIFKR 240
            ..|   ..|..|    |||.:.: ..||:
  Fly    90 VAP---GDLTTC----QLEEVRQVGSFKK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adat1NP_001260450.1 ADEAMc 7..389 CDD:214718 27/94 (29%)
CG5641NP_650196.1 DZF 105..345 CDD:284860 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.