DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adat1 and CG5641

DIOPT Version :10

Sequence 1:NP_609676.1 Gene:Adat1 / 34787 FlyBaseID:FBgn0028658 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_650196.1 Gene:CG5641 / 41529 FlyBaseID:FBgn0038046 Length:396 Species:Drosophila melanogaster


Alignment Length:94 Identity:27/94 - (28%)
Similarity:34/94 - (36%) Gaps:33/94 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 EDSEMVYTGAKLISDLSDDPMLQTP-GALRTKPGRGERTLSMSCSDKIARWNVIGVQGALLDVLI 212
            :||.:.....|...|||..|..||. |.|.||                       || |:||.|:
  Fly    49 DDSALTAALLKRNQDLSPTPSEQTAIGNLVTK-----------------------VQ-AVLDNLV 89

  Fly   213 SKPIYFSSLNFCCDDAQLESLER-AIFKR 240
            ..|   ..|..|    |||.:.: ..||:
  Fly    90 VAP---GDLTTC----QLEEVRQVGSFKK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adat1NP_609676.1 ADEAMc 7..389 CDD:214718 27/94 (29%)
CG5641NP_650196.1 DZF 105..345 CDD:284860 2/7 (29%)

Return to query results.
Submit another query.