DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adat1 and blanks

DIOPT Version :9

Sequence 1:NP_001260450.1 Gene:Adat1 / 34787 FlyBaseID:FBgn0028658 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_647966.1 Gene:blanks / 38620 FlyBaseID:FBgn0035608 Length:324 Species:Drosophila melanogaster


Alignment Length:145 Identity:27/145 - (18%)
Similarity:38/145 - (26%) Gaps:72/145 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NKKPTVKEIAELCLKKFESLPKTGKPTANQWTILAGIVEFNRNTEACQ-LVSLGCGTKCIGESKL 67
            ||:.:|.|            ||  ||....|..:...:..|.....|. :||.|.||        
  Fly   235 NKQTSVVE------------PK--KPLPETWKNMHPCMVLNYMRPQCTFIVSGGTGT-------- 277

  Fly    68 CPNGLILNDSHAEVLARRGFLRFLYQELKQDRIFHWNSTLSTYDMDEHVEFHFLSTQTPCGDACI 132
                                              :.|:|.|               .:.|.|.|.
  Fly   278 ----------------------------------NQNNTFS---------------MSVCVDNCE 293

  Fly   133 LEEEQPAARAKRQRL 147
            ...|.|:.:|.|.:|
  Fly   294 FNAEGPSKKAARYKL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adat1NP_001260450.1 ADEAMc 7..389 CDD:214718 25/142 (18%)
blanksNP_647966.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10910
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.