DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adat1 and CG12493

DIOPT Version :9

Sequence 1:NP_001260450.1 Gene:Adat1 / 34787 FlyBaseID:FBgn0028658 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_647927.3 Gene:CG12493 / 38575 FlyBaseID:FBgn0035571 Length:296 Species:Drosophila melanogaster


Alignment Length:50 Identity:12/50 - (24%)
Similarity:21/50 - (42%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DEDSEMVYTGAKLISDLSDDPMLQTPGALRTKPGRGERTLSMSCSDKIAR 197
            |.:|.:|.|....:|.:.||..:.|....:.|....:...|....|::.|
  Fly    37 DGESSLVITDGDSMSKIPDDAAMATSDPKKKKKKVKKLKRSQKAKDRLVR 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adat1NP_001260450.1 ADEAMc 7..389 CDD:214718 11/49 (22%)
CG12493NP_647927.3 DSRM 229..289 CDD:214634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10910
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.