powered by:
Protein Alignment Adat1 and CG12493
DIOPT Version :9
Sequence 1: | NP_001260450.1 |
Gene: | Adat1 / 34787 |
FlyBaseID: | FBgn0028658 |
Length: | 394 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647927.3 |
Gene: | CG12493 / 38575 |
FlyBaseID: | FBgn0035571 |
Length: | 296 |
Species: | Drosophila melanogaster |
Alignment Length: | 50 |
Identity: | 12/50 - (24%) |
Similarity: | 21/50 - (42%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 DEDSEMVYTGAKLISDLSDDPMLQTPGALRTKPGRGERTLSMSCSDKIAR 197
|.:|.:|.|....:|.:.||..:.|....:.|....:...|....|::.|
Fly 37 DGESSLVITDGDSMSKIPDDAAMATSDPKKKKKKVKKLKRSQKAKDRLVR 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Adat1 | NP_001260450.1 |
ADEAMc |
7..389 |
CDD:214718 |
11/49 (22%) |
CG12493 | NP_647927.3 |
DSRM |
229..289 |
CDD:214634 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45467857 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10910 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.