DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adat1 and CG12493

DIOPT Version :10

Sequence 1:NP_609676.1 Gene:Adat1 / 34787 FlyBaseID:FBgn0028658 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_647927.3 Gene:CG12493 / 38575 FlyBaseID:FBgn0035571 Length:296 Species:Drosophila melanogaster


Alignment Length:50 Identity:12/50 - (24%)
Similarity:21/50 - (42%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DEDSEMVYTGAKLISDLSDDPMLQTPGALRTKPGRGERTLSMSCSDKIAR 197
            |.:|.:|.|....:|.:.||..:.|....:.|....:...|....|::.|
  Fly    37 DGESSLVITDGDSMSKIPDDAAMATSDPKKKKKKVKKLKRSQKAKDRLVR 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adat1NP_609676.1 ADEAMc 7..389 CDD:214718 11/49 (22%)
CG12493NP_647927.3 DSRM_SF 95..155 CDD:444671
DSRM_SF 227..284 CDD:444671
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.