DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adat1 and Strbp

DIOPT Version :10

Sequence 1:NP_609676.1 Gene:Adat1 / 34787 FlyBaseID:FBgn0028658 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_011237345.1 Gene:Strbp / 20744 MGIID:104626 Length:678 Species:Mus musculus


Alignment Length:30 Identity:11/30 - (36%)
Similarity:16/30 - (53%) Gaps:3/30 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 EISVNGKR---QGVTKKKMKTSQAALAISK 320
            |:.|:|::   .|..||..|.|.|..|:.|
Mouse   544 EVEVDGQKFRGAGPNKKVAKASAALAALEK 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adat1NP_609676.1 ADEAMc 7..389 CDD:214718 11/30 (37%)
StrbpXP_011237345.1 DZF 81..334 CDD:128842
DSRM_STRBP_rpt1 384..467 CDD:380738
DSRM_STRBP_rpt2 512..575 CDD:380740 11/30 (37%)
SGP <608..664 CDD:435798
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.