DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ACA7

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_172287.1 Gene:ACA7 / 837326 AraportID:AT1G08080 Length:275 Species:Arabidopsis thaliana


Alignment Length:267 Identity:66/267 - (24%)
Similarity:110/267 - (41%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EENGPAHWAKEYPQ----ASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGY--- 66
            :|.||..|.:..|:    ..|..|||:|:........|.|  ..|...|.|.:. :|.|.|:   
plant    46 DEKGPERWGELKPEWEMCGKGEMQSPIDLMNERVNIVSHL--GRLNRDYNPSNA-TLKNRGHDIM 107

  Fly    67 ------CWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWN 125
                  ...:.:||.:            ::|:|.|.|      ..||||::|..::.|||:||..
plant   108 LKFEDGAGTIKINGFE------------YELQQLHWH------SPSEHTINGRRFALELHMVHEG 154

  Fly   126 TTKYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDV 190
            ..:            .:||:.|..|.|.....:..:...|:.:....:........||.::....
plant   155 RNR------------RMAVVTVLYKIGRADTFIRSLEKELEGIAEMEEAEKNVGMIDPTKIKIGS 207

  Fly   191 HTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMR-------NLNAYDVKEECPCNEFNGK 248
            ..|:.|.||||||||:::|.|.|.:....|:..|:..:|       |.||..|:   |.|:   :
plant   208 RKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAVHDDANSNARPVQ---PTNK---R 266

  Fly   249 VINNFRP 255
            :::.:||
plant   267 IVHLYRP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 66/267 (25%)
ACA7NP_172287.1 alpha_CA_prokaryotic_like 49..270 CDD:239398 63/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.