DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ACA8

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_200444.1 Gene:ACA8 / 835733 AraportID:AT5G56330 Length:350 Species:Arabidopsis thaliana


Alignment Length:121 Identity:33/121 - (27%)
Similarity:59/121 - (48%) Gaps:14/121 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GPAHWA---KEYPQAS-GHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCWRVDV 72
            |||.|.   .|:.... |..|||:|:...:....::..:  |:.:|:|.:| ::.|.|:...:..
plant   149 GPAKWGTLDAEWKMCGIGKMQSPIDLRDKNVVVSNKFGL--LRSQYLPSNT-TIKNRGHDIMLKF 210

  Fly    73 NGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTK 128
            .|.:..: |..:....::|:|.|.|      ..||||::|..::.|.||||.:..|
plant   211 KGGNKGI-GVTIRGTRYQLQQLHWH------SPSEHTINGKRFALEEHLVHESKDK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 33/121 (27%)
ACA8NP_200444.1 alpha_CA_prokaryotic_like 149..333 CDD:239398 33/121 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.