DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ACA2

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001318303.1 Gene:ACA2 / 817367 AraportID:AT2G28210 Length:276 Species:Arabidopsis thaliana


Alignment Length:282 Identity:75/282 - (26%)
Similarity:115/282 - (40%) Gaps:70/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHHWGYTEENGPAHWAKEYPQ----ASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTK--- 59
            |:.|  .:|||||.|.|..|:    ..|..|||:|:.....:..:.|       |.:..|.|   
plant    40 SYEW--NQENGPAKWGKLRPEWKMCGKGEMQSPIDLMNKRVRLVTHL-------KKLTRHYKPCN 95

  Fly    60 -SLVNPGY----------CWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGV 113
             :|.|.|:          ...:.|||.:            :||.|.|.|      ..||||::|.
plant    96 ATLKNRGHDMMLKFGEEGSGSITVNGTE------------YKLLQLHWH------SPSEHTMNGR 142

  Fly   114 SYSGELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLP 178
            .::.|||:||.|..            ..|||:.|..|.|...:.|..:.:.|..:..:.:.....
plant   143 RFALELHMVHENIN------------GSLAVVTVLYKIGRPDSFLGLLENKLSAITDQNEAEKYV 195

  Fly   179 QGCDPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCN 243
            ...||..:......::.|.||||||||:::|||.|.|....|:.:|:..:| :..:|..:     
plant   196 DVIDPRDIKIGSRKFYRYIGSLTTPPCTQNVIWTVVKKVRTVTKNQVKLLR-VAVHDNSD----- 254

  Fly   244 EFNGKVINNFRPPLPLGKRELR 265
                   .|.||..|..||.::
plant   255 -------TNARPVQPTNKRVVK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 73/275 (27%)
ACA2NP_001318303.1 alpha_CA_prokaryotic_like 48..270 CDD:239398 71/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.