DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and car1_predicted

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001072785.1 Gene:car1_predicted / 780246 -ID:- Length:258 Species:Xenopus tropicalis


Alignment Length:240 Identity:105/240 - (43%)
Similarity:132/240 - (55%) Gaps:14/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCWRVDVNGA--DSELTGGPLGDQI 88
            |.|||::|...:||....|.  |||:.|.|:..|.:||.|:|:.|:....  .|.|:.||| |..
 Frog    14 HHQSPININTRTAKYNPSLK--PLKFSYDPKTAKRIVNVGHCFNVEFEDICDKSVLSEGPL-DGH 75

  Fly    89 FKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAGN 153
            ::|.|||.|||.:|..||||.:||..|..|||:||||:.||.||.|||..|||:||:|||||.||
 Frog    76 YRLCQFHFHWGSSDRDGSEHNIDGHLYPAELHIVHWNSKKYTSFAEAAKHPDGVAVVGVFLKLGN 140

  Fly   154 HHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPI 218
            .:..|..:...|..|..||......:....| |||:...||||.|||||.|..|.|.||:.:..|
 Frog   141 TNPALQSIIENLDKVKTKGKACPFTEFHLNG-LLPEDLNYWTYMGSLTTKPYFECVTWIILQEAI 204

  Fly   219 EVSDDQLNAMRNLNAYDVKEECPC-NEFNGKVINNFRPPLPLGKR 262
            .||..||...|.|       :|.. ||....::.|.||..||..|
 Frog   205 TVSSQQLEQFRRL-------QCTSENENPSFILENHRPVQPLDHR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 105/240 (44%)
car1_predictedNP_001072785.1 alpha_CA 16..247 CDD:381753 104/238 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.