DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca13

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001072448.1 Gene:ca13 / 779902 XenbaseID:XB-GENE-992707 Length:263 Species:Xenopus tropicalis


Alignment Length:270 Identity:116/270 - (42%)
Similarity:155/270 - (57%) Gaps:16/270 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHHWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPG 65
            |.|.|||.:.|||..|...:|.|:|.||||::|....|.....|.  ||:..|..:..|.::|.|
 Frog     1 MMHQWGYEDHNGPEVWHDLFPLANGDRQSPINIITRDAIYDPSLQ--PLQVNYDHDSAKVVINTG 63

  Fly    66 YCWRVDVNGAD--SELTGGP-LGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTT 127
            :.:.::.:..|  |.|.||| :|.  ::|.|||.|||.:|..||||.|||:.|:.|||:||||:.
 Frog    64 HTFTMEFDDGDDTSVLRGGPFIGS--YRLRQFHFHWGSSDGHGSEHKVDGMDYAAELHIVHWNSE 126

  Fly   128 KYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHT 192
            |:.||.|||.|||||||||||||.|..:..::::|.....:..||.:... ...||..|||....
 Frog   127 KFSSFVEAACAPDGLAVLGVFLKIGEPNRYIERITDTFGAIRSKGKQSPF-TNFDPSCLLPASMD 190

  Fly   193 YWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRN-LNAYDVKE-ECPCNEFNGKVINNFRP 255
            :|||.||||.||..|||.|:|.|.||.:|.:||...|: |...|..| |..|.:      :|.||
 Frog   191 FWTYPGSLTVPPLLESVTWVVLKEPISISHEQLARFRSLLFTKDTAEIEACCMK------SNHRP 249

  Fly   256 PLPLGKRELR 265
            ..||..|::|
 Frog   250 VQPLKNRKVR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 112/262 (43%)
ca13NP_001072448.1 alpha_CA 1..262 CDD:320708 116/270 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.