DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and XB5797209

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002931952.3 Gene:XB5797209 / 779564 XenbaseID:XB-GENE-5797210 Length:323 Species:Xenopus tropicalis


Alignment Length:288 Identity:97/288 - (33%)
Similarity:137/288 - (47%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEEN---GPAHWAKEYPQASGHRQSPVDITPSSAKKGSEL---------NVAPLKWKYVPEH 57
            |.|:.::   ||.||........|..|||::|..|..|:.|.|         :..|.:||     
 Frog    25 WCYSSQDPKCGPDHWKDISHNCGGESQSPINIERSKVKRDSHLGGISFQGYDHATPGRWK----- 84

  Fly    58 TKSLVNPGYCWRVDVNG----ADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGE 118
               |:|.|:...:.::|    :...::|..| ...::..|||.|||.:...||||.:||..|..|
 Frog    85 ---LINDGHSVLLSLSGEVIQSHVNISGAGL-PNTYRALQFHFHWGSSTRDGSEHLMDGKQYPME 145

  Fly   119 LHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDK-----VTSLLQFVLHKGDRVTLP 178
            ||:||.| .||:|..||...|.||||||.|...    :|:|.     :.:.::.|..||:.:.|.
 Frog   146 LHIVHMN-AKYQSITEAKKDPQGLAVLGFFFTV----SEIDNPSYNTLEAGMKNVSLKGEFIELD 205

  Fly   179 QGCDPGQLLP---DVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEEC 240
            .......|||   .:..|:.|:||||||.|||.|||.||:.||.:|..||..|.....:..    
 Frog   206 STFPLEMLLPPHDKLSRYYRYQGSLTTPDCSEVVIWTVFEDPISISQKQLKIMTETAHFTA---- 266

  Fly   241 PCNEFNG----KVINNFRPPLPLGKREL 264
                 ||    |:.:|||.|.||..|::
 Frog   267 -----NGETLVKMSDNFRTPQPLKGRKV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 96/285 (34%)
XB5797209XP_002931952.3 Carb_anhydrase 46..287 CDD:395141 90/263 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.