DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and zgc:153760

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001070086.1 Gene:zgc:153760 / 767680 ZFINID:ZDB-GENE-060929-528 Length:324 Species:Danio rerio


Alignment Length:286 Identity:96/286 - (33%)
Similarity:133/286 - (46%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEENGPA----HWAKEYPQ-ASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNP 64
            |.|   |.||    :|....|| .:|..|||:||..:..:....|....|..........|:.|.
Zfish    26 WCY---NNPACNFPNWPNIAPQYCNGSSQSPIDIVTAQVQGNPNLTQFILTGFDANTTFTSITNS 87

  Fly    65 GYCWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDS-KGSEHTVDGVSYSGELHLVHWNTTK 128
            |....|.::.....:.||.| ..::...|||.|||.:.| .||||||||..|:.|||:|:.::|.
Zfish    88 GTSVVVSLDEDIMSVQGGDL-PGLYVSVQFHLHWGSSSSLPGSEHTVDGKQYAMELHIVNLHSTY 151

  Fly   129 YKSFGEAAAAPD--GLAVLGVFLKAGNHHAE----LDKVTSLLQFVLHKG-------DRVTLPQG 180
            ..:...|.||.|  .|||||.|:: |...|:    .|..||.|..:.:.|       |::|:   
Zfish   152 NGNVSAALAANDSSALAVLGFFIE-GTDEADKTNSWDVFTSFLSNIPNSGNTYTDIMDQITM--- 212

  Fly   181 CDPGQLLPDVH--TYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCN 243
               ..||..|:  .|:.|:||||||||:|.|||.|||.||:|:::.:|..             |.
Zfish   213 ---NSLLEGVNKTKYYRYQGSLTTPPCNEDVIWTVFKEPIKVNNNLINRF-------------CT 261

  Fly   244 EFNGKV-------INNFRPPLPLGKR 262
            :...|.       :||||...||..|
Zfish   262 KVFAKTAKASDLNVNNFRGVQPLNGR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 96/286 (34%)
zgc:153760NP_001070086.1 alpha_CA_IV_XV_like 48..291 CDD:239391 88/261 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.