DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and CA8

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001308766.1 Gene:CA8 / 767 HGNCID:1382 Length:290 Species:Homo sapiens


Alignment Length:270 Identity:102/270 - (37%)
Similarity:149/270 - (55%) Gaps:21/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCWR 69
            |||.|   ...|...:|.|:|..|||:::....|:....|....|...||......:.|.|:..:
Human    29 WGYEE---GVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQ 90

  Fly    70 VDVNGADSELTGGPL--GDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSF 132
            | :..:.|.|:||||  |.: |:|.:...|||..:.:||||||:..::..||||:|||:|.:.|.
Human    91 V-ILKSKSVLSGGPLPQGHE-FELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSI 153

  Fly   133 GEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGC-DPGQLLPD--VHTYW 194
            .||...|.|:|::.:|::.|..|..|..||.:||.:.:||...|:|  | :|..||||  :..||
Human   154 DEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIP--CFNPNTLLPDPLLRDYW 216

  Fly   195 TYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAY----DVKEECPCNEFNGKVINNFRP 255
            .||||||.|||||.|.||:|:.|:.:|..|:...|.|..:    ::.|.|     :|.:.:||||
Human   217 VYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGC-----DGILGDNFRP 276

  Fly   256 PLPLGKRELR 265
            ..||..|.:|
Human   277 TQPLSDRVIR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 100/266 (38%)
CA8NP_001308766.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
alpha_CARP_VIII 35..289 CDD:239394 98/261 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.