DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and CA6

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011540386.1 Gene:CA6 / 765 HGNCID:1380 Length:324 Species:Homo sapiens


Alignment Length:283 Identity:91/283 - (32%)
Similarity:142/283 - (50%) Gaps:27/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTE-ENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCW 68
            |.|:| ....|||.:.||...|.||||:::..:..:....|....:...........:||.|:..
Human    27 WTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTV 91

  Fly    69 RVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSK--GSEHTVDGVSYSGELHLVHWNTTKYKS 131
            ::.:   .|.:........::..:|.|.|||...|:  ||||||||:.:..|:|:||:| :||||
Human    92 QISL---PSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYN-SKYKS 152

  Fly   132 FGEAAAAPDGLAVLGVFLKAGNH--HAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLP-DVHTY 193
            :..|..||||||||..|::..|:  :.......|.|..:.:.|.|.|| .|.|...:|| ::..|
Human   153 YDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTL-TGLDVQDMLPRNLQHY 216

  Fly   194 WTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEF------NGKVINN 252
            :||.||||||||:|:|.|.|....:::|..|:..:.| :..|.:.:...|::      |.:|:.:
Human   217 YTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLEN-SLLDHRNKTIHNDYRRTQPLNHRVVES 280

  Fly   253 FRPP-----LPLGKRELREIGGH 270
            ..|.     :|.||..    |||
Human   281 NFPNQENAYIPSGKGH----GGH 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 88/274 (32%)
CA6XP_011540386.1 alpha_CA_VI 35..283 CDD:239399 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.