DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and Car12

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006511611.1 Gene:Car12 / 76459 MGIID:1923709 Length:355 Species:Mus musculus


Alignment Length:273 Identity:98/273 - (35%)
Similarity:150/273 - (54%) Gaps:19/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLK---WKYVPEHTKSLVNPGY 66
            |.|....|..:|:|:||...|..|||:|:.....:..:.|  |||:   :....|...:|.|.|:
Mouse    32 WTYVGPAGEKNWSKKYPSCGGLLQSPIDLHSDILQYDASL--APLQFQGYNVSVEKLLNLTNDGH 94

  Fly    67 CWRVDVNGADSELTGGPLGDQIFKLEQFHCHWG-CTDSKGSEHTVDGVSYSGELHLVHWNTTKYK 130
            ..|:::| :|..:.|  |....::.||.|.||| ..|..||||||.|..::.|||:||:|:..|.
Mouse    95 SVRLNLN-SDMYIQG--LQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYP 156

  Fly   131 SFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPD-VHTYW 194
            .|..|:...:|||||.|.::.|:.:...||:.|.||.|.:||.:|.:| |.:..:|||: ...|:
Mouse   157 DFSTASDKSEGLAVLAVLIEIGSANPSYDKIFSHLQHVKYKGQQVLIP-GFNIEELLPESPGEYY 220

  Fly   195 TYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPLPL 259
            .||||||||||..:|:|.||:.|:::|.:||.|:.....:...::....|    :|||||.....
Mouse   221 RYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPRE----MINNFRQVQKF 281

  Fly   260 GKR----ELREIG 268
            .:|    ..|::|
Mouse   282 DERLVYISFRQVG 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 96/266 (36%)
Car12XP_006511611.1 alpha_CA 39..290 CDD:381753 94/260 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.