DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and CA5A

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011521611.1 Gene:CA5A / 763 HGNCID:1377 Length:376 Species:Homo sapiens


Alignment Length:165 Identity:67/165 - (40%)
Similarity:95/165 - (57%) Gaps:7/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NGPAH--WAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCWRVDVN 73
            |...|  |........|.||||::|....:....:|.  ||:..|.......:.|.||.::|:.:
Human    45 NNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLK--PLRVSYEAASCLYIWNTGYLFQVEFD 107

  Fly    74 GAD--SELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSFGEAA 136
            .|.  |.::|||| :..::|:|||.|||..:..||||||||.:|..||||||||:.||:::.||.
Human   108 DATEASGISGGPL-ENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAV 171

  Fly   137 AAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHK 171
            ...:||||:|||||.|.||..|.::..:|..:.||
Human   172 VGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 67/165 (41%)
CA5AXP_011521611.1 alpha_CA 61..>212 CDD:294017 64/149 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2507
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3457
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm42196
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.