DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca5b

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001039155.1 Gene:ca5b / 733981 XenbaseID:XB-GENE-1003819 Length:319 Species:Xenopus tropicalis


Alignment Length:260 Identity:112/260 - (43%)
Similarity:146/260 - (56%) Gaps:14/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YTEENGPAH--WAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCWR 69
            |...|...|  |..|.....|.||||::|....:....:|  ||:..:|.|.....:.|.||.:.
 Frog    43 YKLRNVDLHPLWRGEIEVPGGSRQSPINIRIRDSVFHPQL--APVHTQYDPNTCLYIWNNGYSFF 105

  Fly    70 VDVNGA--DSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSF 132
            |:.:.:  .|.::|||| :..|:|:|||.|||..:..|||||||...:..||||||||.:||::|
 Frog   106 VEYDDSTDKSTVSGGPL-ENPFRLKQFHFHWGRNNDWGSEHTVDSRVFPAELHLVHWNCSKYRTF 169

  Fly   133 GEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHTYWTYE 197
            .||...|:||||:|||||.|.||.:|.|:..:|..|.:| |.:|.....|...|||....||||.
 Frog   170 EEAIMEPNGLAVIGVFLKVGKHHEKLQKLVDILPSVRYK-DALTEFNYFDSSCLLPSCGDYWTYS 233

  Fly   198 GSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPLPLGKR 262
            |||||||.:|||.||:.|.||||...||...|:|....|.||      ...:::||||..||..|
 Frog   234 GSLTTPPLTESVTWIIMKKPIEVDHSQLAVFRSLLFTAVGEE------ERYMVDNFRPLQPLMNR 292

  Fly   263  262
             Frog   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 112/260 (43%)
ca5bNP_001039155.1 alpha_CA_V 63..298 CDD:239392 107/240 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2444
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3370
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm49425
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.