DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and Car10

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001348636.1 Gene:Car10 / 72605 MGIID:1919855 Length:328 Species:Mus musculus


Alignment Length:306 Identity:89/306 - (29%)
Similarity:141/306 - (46%) Gaps:78/306 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EENGP----AHWA-KEYPQAS--------------------GHRQSPVDI-----------TPSS 37
            ::|.|    ..|| ||..|.|                    |.|||||:|           ||..
Mouse    22 QQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLR 86

  Fly    38 AKKGSELNVAPLKWKYVPEHTKSLVNPG--YCWRVD----VNGADSELTGGPLGDQIFKLEQFHC 96
            ...|..            :.:.::.|.|  ...|:|    ||     ::|||: ....:||:...
Mouse    87 INTGGR------------KVSGTMYNTGRHVSLRLDKEHLVN-----ISGGPM-TYSHRLEEIRL 133

  Fly    97 HWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAG-------NH 154
            |:|..||:||||.::|.::|||:.|:|:|...|.:..|||.:|:||.|:.:|:|..       |.
Mouse   134 HFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNR 198

  Fly   155 HAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIE 219
            ....|.:|.    :.:|.|...| ||.:..:|.|:..::.||:||:|.|||.|:..||:...|:.
Mouse   199 MLNRDTITR----ITYKNDAYLL-QGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVY 258

  Fly   220 VSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPLPLGKRELR 265
            ::..|::::|.|:     :..|...|. .:.:||||..||..|.:|
Mouse   259 ITRMQMHSLRLLS-----QNQPSQIFL-SMSDNFRPVQPLNNRCIR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 87/302 (29%)
Car10NP_001348636.1 alpha_CARP_X_XI_like 46..302 CDD:239395 81/282 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.