DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and PTPRG

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_016862450.1 Gene:PTPRG / 5793 HGNCID:9671 Length:1485 Species:Homo sapiens


Alignment Length:329 Identity:86/329 - (26%)
Similarity:129/329 - (39%) Gaps:81/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPL----------KW-KYVPEH 57
            :|.|:...||.||........|..|||:||....|:.|.|.....|          .| |...:.
Human    59 YWAYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKT 123

  Fly    58 TKSLVNPGYCWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTD-SKGSEHTVDGVSYSGE--- 118
            ...|:...|.    |:||.  |.|.      ||.|:...|||.:: |.||||:::|..:..|   
Human   124 VAILLKDDYF----VSGAG--LPGR------FKAEKVEFHWGHSNGSAGSEHSINGRRFPVEAED 176

  Fly   119 -------------------------------------LHLVHWNTTKYKSFGEAAAAPDGLAVLG 146
                                                 :.:..:|...:.||..|.:....:..:.
Human   177 ARGGDIMLMLSQGMRFILLGLKKEQFEERKSWTTYQSMQIFFYNPDDFDSFQTAISENRIIGAMA 241

  Fly   147 VFLKAG-NHHAELDKVTSLLQFVLHKGDRVTLPQGCDP---GQLLP-DVHTYWTYEGSLTTPPCS 206
            :|.:.. ..::.||.:...|:.|:|......|    ||   ..||| .:.:|:.|.|||||||||
Human   242 IFFQVSPRDNSALDPIIHGLKGVVHHEKETFL----DPFVLRDLLPASLGSYYRYTGSLTTPPCS 302

  Fly   207 ESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPLPL-----GKRELRE 266
            |.|.||||:.|:.:|..||.|..::...:.::.....|:   :.|||||...|     .|..:|:
Human   303 EIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEY---LRNNFRPQQRLHDRVVSKSAVRD 364

  Fly   267 IGGH 270
            ...|
Human   365 SWNH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 84/319 (26%)
PTPRGXP_016862450.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.