DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca10b

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_005164153.1 Gene:ca10b / 568543 ZFINID:ZDB-GENE-080815-2 Length:326 Species:Danio rerio


Alignment Length:254 Identity:79/254 - (31%)
Similarity:128/254 - (50%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTK-SLVNPGYCWRVDVNGADSEL---TGGP 83
            |.|.|||||:|..|.......||  ||:......... ::.|.|.  .|.:....|.|   :|||
Zfish    60 AIGKRQSPVNIETSRMIFDPFLN--PLRLNAGQRKVSGTMYNTGR--HVSLRPDKSHLVNISGGP 120

  Fly    84 LGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSFGEAAAAPDGLAVLGVF 148
            | ...::||:...|:|..|::||||.::|.::.||:.|:|:|...|.::.:|..:|:|:||:.:|
Zfish   121 L-SYSYRLEEIRLHFGSEDNRGSEHLLNGQAFPGEVQLIHYNQDLYLNYSDAVRSPNGIAVVSIF 184

  Fly   149 LKAG-------NHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHTYWTYEGSLTTPPCS 206
            :|..       |.....:.||.    :.:|.|...| .|.:..:|.|:...:.|||||:|.|||.
Zfish   185 MKISEPTNVFLNRMLNRETVTR----ITYKHDAYLL-MGLNIEELYPETSRFITYEGSITIPPCL 244

  Fly   207 ESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPLPLGKRELR 265
            |:..||:...||.:|..::.::|.|:     :..|...|. .:.:|.||...|.:|.:|
Zfish   245 ETATWILMNKPIYISQIEMQSLRLLS-----QNQPSQIFL-SMGDNMRPTQTLHQRCIR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 77/250 (31%)
ca10bXP_005164153.1 PLN02179 7..257 CDD:177835 67/206 (33%)
alpha_CARP_X_XI_like 45..301 CDD:239395 79/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.