DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca15a

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001075158.1 Gene:ca15a / 553469 ZFINID:ZDB-GENE-070424-7 Length:324 Species:Danio rerio


Alignment Length:275 Identity:91/275 - (33%)
Similarity:135/275 - (49%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEENGPAHWAKEYPQASGH-----RQSPVDITPSSAKKGSELNVAPLKWKYVPEHTK--SLV 62
            |.|   |.|......:|:.|.|     .|||::|..:...:.|  |:....:.....:|.  |:.
Zfish    26 WCY---NNPLCNFTTWPELSPHYCNGSSQSPINIVTAQVLENS--NLTQFNFTGFDANTTFISMA 85

  Fly    63 NPGYCWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDS-KGSEHTVDGVSYSGELHLVHWNT 126
            |.|....|.::.....:.||.| ..::..:|||.|||.:.| .||||||||..|:.|||:|:.::
Zfish    86 NSGISVVVTLDEEIMSVQGGDL-PGLYVSKQFHLHWGNSSSFPGSEHTVDGKQYAMELHIVNVHS 149

  Fly   127 TKYKSFGEAAAAPD--GLAVLGVFLKAGNHHAELDK----VTSLLQFVLHKGD-RVTLPQGCDPG 184
            ....|...|.||.|  .|||||.|:: |.:.|...|    :||.|:.:.:.|: .|.:.......
Zfish   150 KYNGSLSAALAANDSSALAVLGFFIE-GTNEASKAKGWGVLTSFLRNITYSGNATVDIMNRTSMN 213

  Fly   185 QLLPDVH--TYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNG 247
            .||..|:  .|:.|.||||||.|:|:|||.|||.||:|:::.:| :.:...:......|...   
Zfish   214 SLLEGVNKTKYYRYRGSLTTPSCNEAVIWTVFKEPIKVNNNLIN-LFSTTVFAKNASAPVLN--- 274

  Fly   248 KVINNFRPPLPLGKR 262
              :||||...||..|
Zfish   275 --VNNFRGVQPLNGR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 91/275 (33%)
ca15aNP_001075158.1 alpha_CA_IV_XV_like 48..291 CDD:239391 84/250 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.