DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca4b

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001159683.1 Gene:ca4b / 553246 ZFINID:ZDB-GENE-080815-5 Length:304 Species:Danio rerio


Alignment Length:267 Identity:88/267 - (32%)
Similarity:130/267 - (48%) Gaps:30/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHHWGY----TEEN----GPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHT 58
            |..|.|    |..|    ||..||........::|||::|..:.|...|.|  .|:::....|..
Zfish    18 SAEWCYQTQVTCSNHSCIGPDDWATVAAACGNNKQSPINIVTNKASTDSRL--TPVQFTDYQERL 80

  Fly    59 KS-LVNPGYCWRVDVNGAD-SELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHL 121
            .: :||.|:  .|.:|..| :::.|..|| ..:|.:|.|.|||.....|||||:||..:..|||:
Zfish    81 NAVIVNNGH--TVQINLPDRAKINGANLG-STYKAQQLHLHWGKNGGPGSEHTIDGEKFPMELHV 142

  Fly   122 VHWNTTKYKSFGEAAAAPDGLAVLGVFL-KAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQ 185
            ||.. .:|.|..:|.....|:||||.|. ::.|.:...|.:.:.|..:.|......| .......
Zfish   143 VHIK-EEYNSLEQAVGDSSGVAVLGFFYEESENANKNYDAIINSLTNITHPESNAEL-GAISLDM 205

  Fly   186 LLP--DVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGK 248
            |:|  |:..|:.||||||||.|:|:|:|.:|:..|.:|.:||:|..||...|          ...
Zfish   206 LIPNEDLDKYFRYEGSLTTPGCAEAVVWTIFEKTIPLSKEQLSAFSNLTFSD----------GAA 260

  Fly   249 VINNFRP 255
            ::|.|||
Zfish   261 MVNTFRP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 87/264 (33%)
ca4bNP_001159683.1 alpha_CA_IV_XV_like 50..278 CDD:239391 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.