DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca12

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001016431.1 Gene:ca12 / 549185 XenbaseID:XB-GENE-1015246 Length:335 Species:Xenopus tropicalis


Alignment Length:266 Identity:89/266 - (33%)
Similarity:134/266 - (50%) Gaps:20/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HHWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLK---WKYVPEHTKSLVNP 64
            |.|.|....|...|.|.|....|..|||:||.....:..|.|.  |:|   :...|..:.:|.|.
 Frog    21 HGWAYIGTKGEKSWPKNYEFCGGVYQSPIDIHQDILQYDSSLQ--PVKLNGYNVSPAESFTLSNN 83

  Fly    65 GYCWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDS-KGSEHTVDGVSYSGELHLVHWNTTK 128
            |:..::.: ....::...|..   :...|.|.|||...: |||||.::|..::||:|||::|:.|
 Frog    84 GHTVQMSL-VPTMQIKIAPFH---YTASQLHLHWGQRGTQKGSEHCIEGKRFAGEVHLVNYNSDK 144

  Fly   129 YKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPD-VHT 192
            |.....|....|||||||:.|:.|..:...:|:.|.|..:.:|...|.: .|.:..:|||. :..
 Frog   145 YSDITTAMKESDGLAVLGILLEVGPFNPTFEKIISQLHSIGYKDQSVQI-AGFNVQELLPKRLDE 208

  Fly   193 YWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRN-LNAYDVKEECPCNEFNGKVINNFRPP 256
            |:.||||||||||..||:|.||:.|:.:|::||..:.. |.:.|..|..       ::.||:|..
 Frog   209 YYRYEGSLTTPPCYPSVLWTVFRNPVTISEEQLITLETALYSTDRNESV-------QMTNNYRQL 266

  Fly   257 LPLGKR 262
            .|.|.|
 Frog   267 QPHGDR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 88/264 (33%)
ca12NP_001016431.1 alpha_CA_XII_XIV 30..278 CDD:239400 86/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.