DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca7

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001015903.1 Gene:ca7 / 548657 XenbaseID:XB-GENE-1017206 Length:266 Species:Xenopus tropicalis


Alignment Length:267 Identity:128/267 - (47%)
Similarity:164/267 - (61%) Gaps:14/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HHWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKS--LVNPG 65
            |.|||.||:||:.|...:|.|.|:||||:||..:.|.....||  ||...|  :|..|  |.|.|
 Frog     5 HCWGYGEEDGPSEWHHYFPIAEGNRQSPIDIVSNQAVFNPSLN--PLVISY--DHCTSINLSNNG 65

  Fly    66 YCWRVDVNGADSE--LTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTK 128
            :...|:.:..|.:  :||||| :..::|:|||.|||...:.||||||||.||..||||||||...
 Frog    66 HSVMVEFDDYDDKTVITGGPL-EGSYRLKQFHFHWGTQRNSGSEHTVDGKSYPCELHLVHWNARA 129

  Fly   129 YKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHTY 193
            |.||||||||||||.|:||||:.|..|:.|:::|..|..|..||.: |.....:|..|||....|
 Frog   130 YSSFGEAAAAPDGLVVIGVFLETGGQHSGLNRLTDALYMVKFKGTK-TQFDDFNPKCLLPSSFEY 193

  Fly   194 WTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPLP 258
            |||.|||||||.:|||.|||.|.||:||:.|:...|....:..:||    |....::||||||.|
 Frog   194 WTYPGSLTTPPLNESVTWIVLKEPIKVSEKQMERFRKTLLFSGEEE----EQRIHMVNNFRPPQP 254

  Fly   259 LGKRELR 265
            |..|:::
 Frog   255 LKGRKVQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 126/261 (48%)
ca7NP_001015903.1 alpha_CA_VII 27..264 CDD:239402 117/245 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2444
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55875
Inparanoid 1 1.050 229 1.000 Inparanoid score I3370
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm49425
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.