DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and CAH5

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097988.2 Gene:CAH5 / 50102 FlyBaseID:FBgn0040629 Length:302 Species:Drosophila melanogaster


Alignment Length:255 Identity:86/255 - (33%)
Similarity:125/255 - (49%) Gaps:50/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SGHRQSPVDITPSSAKKGSELNVA-----------PLKWKYV---PEHTKSLVNP----GYCWRV 70
            ||..|||:|:....:|     .||           ||:...|   ..||.::|.|    |.  |.
  Fly    58 SGENQSPIDLIFEDSK-----IVAIPRLRFNNYDQPLQTPLVITNNGHTANMVIPQTRGGQ--RP 115

  Fly    71 DVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSFGEA 135
            .:||  |.|.|.      |:.:..|.|||..::|||||.::...|..|:|:||.||. |::.|||
  Fly   116 SING--SLLPGN------FEAQSVHFHWGSREAKGSEHAINFQRYDVEMHIVHKNTI-YETMGEA 171

  Fly   136 AAAPDGLAVLGVFLKA----GNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHT--YW 194
            ...|||||||||..:|    .:.|..|:|:.:.|..::......|:......||||.::.|  ::
  Fly   172 TMHPDGLAVLGVMFRAVDRQTSQHYGLNKIFNQLPRIVQYNSNATITGRLTVGQLLGNIVTGEFF 236

  Fly   195 TYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFR 254
            ||.||||||.|:|:|.|.||...::....|:..:.||.  |.::.        .:|||:|
  Fly   237 TYNGSLTTPDCAEAVTWTVFPDVLDYPRRQITKLWNLR--DSRQR--------PLINNYR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 86/255 (34%)
CAH5NP_001097988.2 Carb_anhydrase 43..294 CDD:215000 86/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446781
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.800

Return to query results.
Submit another query.