DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca8

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001011213.1 Gene:ca8 / 496646 XenbaseID:XB-GENE-953676 Length:282 Species:Xenopus tropicalis


Alignment Length:273 Identity:100/273 - (36%)
Similarity:149/273 - (54%) Gaps:21/273 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHHWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGY 66
            :..|||.|   ...|...||:|:|..|||::|....|.....|....|...||......::|.|:
 Frog    18 NQEWGYEE---GVEWGLLYPEANGDYQSPININSREAMYDPSLLEVRLTPSYVVCRDCEVINDGH 79

  Fly    67 CWRVDVNGADSELTGGPL--GDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKY 129
            ..::.:. :.|.|.||||  |.: ::|.:...|||..:.:||||||:..::..||||:|||:|.|
 Frog    80 VVQILLK-SKSVLKGGPLPRGHE-YELNEVRFHWGKENQRGSEHTVNFKAFPMELHLIHWNSTLY 142

  Fly   130 KSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGC-DPGQLLPD--VH 191
            :|..||.....|:.::.:|::.|..:..|..:|.:||.:.:||...|:|  | :|..||||  :.
 Frog   143 RSLEEAMGKVHGIVIISLFVQIGKENIGLKAITEVLQDIFYKGKSKTIP--CFNPNTLLPDPLLR 205

  Fly   192 TYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAY----DVKEECPCNEFNGKVINN 252
            .||.||||||.|||||.|.||:|:.|:.||..|:...|.|..:    |:.:.|     :|.:.:|
 Frog   206 DYWVYEGSLTMPPCSEGVTWILFRYPLTVSQTQIEEFRRLRTHIKGADLPDGC-----DGLMADN 265

  Fly   253 FRPPLPLGKRELR 265
            |||..||..|.:|
 Frog   266 FRPTQPLSDRIIR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 98/266 (37%)
ca8NP_001011213.1 alpha_CARP_VIII 26..281 CDD:239394 96/262 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.