DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and CAH6

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097987.1 Gene:CAH6 / 43701 FlyBaseID:FBgn0039838 Length:298 Species:Drosophila melanogaster


Alignment Length:275 Identity:89/275 - (32%)
Similarity:128/275 - (46%) Gaps:38/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPL------KWKYVPEHTKSLV 62
            ||.| |.|| .:|....  ::|.||||:.:....:.      :.||      .:........:|:
  Fly    29 HWDY-ETNG-QNWGGIC--STGERQSPISLNVQKSL------IVPLPRIVFGNYDVKLRGPLTLL 83

  Fly    63 NPGYCWRVDV----NGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVH 123
            |.|:...|::    ||....:|||.|..: |..|.||.|||...|:||||:::...:..|:|:||
  Fly    84 NNGHTAHVEIPETANGNKPFITGGLLKGR-FVAEAFHFHWGSPSSRGSEHSINQQRFDVEMHIVH 147

  Fly   124 WNTTKYKSFGEAAAAPDGLAVLGVFLKAGNH----HAELDKVTSLLQFVLHKGDRVTLPQGCDPG 184
            .| .||....||....||:||:||.||...:    ...|.||.|.|..|.....:.|:|.|...|
  Fly   148 RN-EKYGDIDEAKNKKDGIAVIGVMLKIVKNPNRIFPGLSKVMSALPRVTKYNAKTTIPGGLSLG 211

  Fly   185 QLLPDVH--TYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNG 247
            |:|.:|:  .::||.||||||.|.:||.|.||...:.|....::....|.          :....
  Fly   212 QMLGNVNPRDFFTYRGSLTTPLCEQSVTWTVFSQVLPVPYSSVSKFWKLR----------DSEGH 266

  Fly   248 KVINNFRPPLPLGKR 262
            ::|||||...|...|
  Fly   267 RLINNFRDIQPRNGR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 88/274 (32%)
CAH6NP_001097987.1 Carb_anhydrase 30..282 CDD:215000 88/274 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446782
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.800

Return to query results.
Submit another query.