DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and CAH9

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster


Alignment Length:286 Identity:96/286 - (33%)
Similarity:143/286 - (50%) Gaps:35/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHHWGYTEENGPAHWAKEYPQASGHRQSPVDIT---------PSSAKKGSELNVAPLKWKYVPE- 56
            ||.:||:|.| ...||:.:...:|..|||:.||         |:....|.. |:.|...|.:.. 
  Fly    22 SHVFGYSEPN-QRRWARHHGHCAGKTQSPIAITTSRTTAIHMPAVDMIGYH-NLLPYPLKMINNG 84

  Fly    57 HTKSLVNPGYCWRVDVNGADSE----LTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSG 117
            ||.|:..|    :|:|.....:    :.|..|..: |::|..|.|||..:::||||.::.:.|:.
  Fly    85 HTVSITIP----KVNVTEVGEDFLPYIRGAKLPGE-FEVEGLHFHWGDKNNRGSEHVINDIRYTM 144

  Fly   118 ELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAG-NHHAELDKVTSLLQFVLHKGDRVTLPQGC 181
            |:|:||.| .||.:.|||...|||.||||.|.... :..|.|..:...|..:.......||....
  Fly   145 EMHIVHRN-KKYATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLHLIADANQEATLNVTF 208

  Fly   182 DPGQLLP--DVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNE 244
            ....|:.  ||..::||:||||||||||:|.||:|..||.:|..|::..|.|:  |.::      
  Fly   209 SLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQISRFRQLS--DTQD------ 265

  Fly   245 FNGKVINNFRPPLPLGKRELREIGGH 270
              |.:::|||...|:|.|.:....||
  Fly   266 --GALVDNFRTLQPVGNRRIFARTGH 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 91/274 (33%)
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 91/274 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446783
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.800

Return to query results.
Submit another query.