DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and CAH7

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster


Alignment Length:269 Identity:90/269 - (33%)
Similarity:136/269 - (50%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHHWGYTEENGPAHWAKEYPQ-----ASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSL 61
            ::.|||.:.:.  :..:.:|:     .||.:|||:::....|.|| |.:.  ||::...||.|:|
  Fly    19 ANEWGYPDLDN--NQDEPFPKWGGLCDSGKKQSPINLHVKGALKG-EFDA--LKFENYDEHQKNL 78

  Fly    62 --VNPGYCWRVDVNGADSELT--GGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLV 122
              ||.|:  .:.::|.|.|||  ||.| .|.|.:||.|.||      .||||::.:.|..|:|:|
  Fly    79 RMVNNGH--SIQLSGFDHELTLSGGAL-LQDFVVEQIHMHW------WSEHTINDIRYPLEVHIV 134

  Fly   123 HWNTTKYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFV--LHKGDRVTLP----QGC 181
            |.||. |.:...||...||:.|:||.....|...|  .:.|:::.:  :...|.:..|    ...
  Fly   135 HRNTI-YPNMTMAANFKDGIVVIGVLYHVSNTPNE--AIGSIIKSLGAVKSYDSMNKPVLVADSL 196

  Fly   182 DPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFN 246
            ....|:|.|..|:||.||||||.|:|:|.|||......|:.||:|..:.:. ||          .
  Fly   197 AVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQVNEFKEIE-YD----------E 250

  Fly   247 GKVI-NNFR 254
            ||.: ||:|
  Fly   251 GKQLHNNYR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 90/266 (34%)
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 85/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446818
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.800

Return to query results.
Submit another query.