DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca4c

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001373159.1 Gene:ca4c / 407683 ZFINID:ZDB-GENE-080815-6 Length:309 Species:Danio rerio


Alignment Length:276 Identity:79/276 - (28%)
Similarity:126/276 - (45%) Gaps:44/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHHWGYTEE-------NGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTK 59
            |..|.|..:       .||:.|...|....|.:|||::|..|             |.||.|:.|.
Zfish    18 SGEWCYQSQLSCNHTCEGPSQWKINYTSCGGQKQSPINIITS-------------KVKYDPKLTS 69

  Fly    60 ------------SLVNPGYCWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDG 112
                        |:.|.|:.....: ...:.|:||.|..: :|..|||.|||...|:||||:|||
Zfish    70 FIFHGHEDAFNMSVENHGHSAHFTL-PPSAHLSGGGLKGK-YKAVQFHLHWGENGSQGSEHSVDG 132

  Fly   113 VSYSGELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLK-AGNHHAELDKVTSLLQFVLHKGDRVT 176
            ..|..|||:|:.. .:|.:..:|.....|:|||..|.: ....:.:.:::...|:.|.|: :..:
Zfish   133 ERYPMELHIVYIG-EEYINLTKALQNSTGVAVLAFFFEVTALQNQKFERIIEALKKVRHE-NTTS 195

  Fly   177 LPQGCDPGQLLPDVHT--YWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEE 239
            ..:......::|.|::  |:.|.||||||.|.|:|:|.||:..|.:|..|:.:|..|..:...:.
Zfish   196 KVENFKLSDIIPQVNSQKYYRYSGSLTTPSCEEAVLWTVFQQTIGISKMQMESMDKLLLFGTDKP 260

  Fly   240 C-----PCNEFNGKVI 250
            .     |....|.:|:
Zfish   261 MAGIFRPVQNLNERVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 78/273 (29%)
ca4cNP_001373159.1 alpha_CA_IV_XV_like 48..277 CDD:239391 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.