DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and CAH14

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster


Alignment Length:267 Identity:63/267 - (23%)
Similarity:100/267 - (37%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ASGHRQ---------SPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLV--NPGYCWRVDVNGAD 76
            |.|:|:         ||:.|..|:..| .:|.: ||.|.|..:...:.|  |.|....:.:..|:
  Fly    59 AVGNRRLEMKLAKQPSPITIPESNMIK-RQLKM-PLHWTYYEDLPMATVLENNGNTVIMRIYTAN 121

  Fly    77 S---ELTGGPL------GDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHW-----NTT 127
            :   :|:|..|      .:.|||       ||   |..|||::...::..||..:|.     |..
  Fly   122 NFMPQLSGAELLGRYQFVEAIFK-------WG---SLKSEHSIGKHNFCLELQALHRCAQLNNNF 176

  Fly   128 KYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHT 192
            :|.:          |:.|.......|.|  |.:||..|:::...|..:.||.......|.|....
  Fly   177 EYLT----------LSYLFALSHVKNEH--LKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSG 229

  Fly   193 YWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPL 257
            |::|||:...........|::.:....|...||:....|...:....|          .|.|...
  Fly   230 YFSYEGTYDNGDVVLPTTWLINRKISVVDSRQLSEFEALYGRNGNRNC----------KNGREKQ 284

  Fly   258 PLGKREL 264
            |||.|.:
  Fly   285 PLGNRNV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 62/264 (23%)
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 60/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.