DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and Ca12

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001074225.1 Gene:Ca12 / 363085 RGDID:1306612 Length:354 Species:Rattus norvegicus


Alignment Length:255 Identity:95/255 - (37%)
Similarity:145/255 - (56%) Gaps:15/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLK---WKYVPEHTKSLVNPGY 66
            |.|....|..:|:|:||...|..|||:|:.....:..:.|  |||:   :....|...:|.|.|:
  Rat    32 WTYIGPAGEKNWSKKYPSCGGLLQSPIDLHSDILQYDASL--APLQFQGYNVSVEKLLNLTNDGH 94

  Fly    67 CWRVDVNGADSELTGGPLGDQIFKLEQFHCHWG-CTDSKGSEHTVDGVSYSGELHLVHWNTTKYK 130
            ..|:::| :|..:.|  |....::.||.|.||| ..|..||||||.|..::.|||:||:|:..|.
  Rat    95 SVRLNLN-SDMYIQG--LQPHQYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYS 156

  Fly   131 SFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPD-VHTYW 194
            .||.|:...:|||||.|.::.|:.:...||:.|.||.|.:||.:|.:| |.:..:|||: ...|:
  Rat   157 DFGSASDKSEGLAVLAVLIEIGSVNPSYDKIFSHLQHVKYKGQQVLIP-GFNIEELLPESPGEYY 220

  Fly   195 TYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFR 254
            .||||||||||..:|:|.||:.|:::|.:||.|:.....:...::....|    ::||||
  Rat   221 RYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPSPRE----MVNNFR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 95/255 (37%)
Ca12NP_001074225.1 alpha_CA 39..290 CDD:294017 93/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.