DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and CAH13

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_610602.2 Gene:CAH13 / 36126 FlyBaseID:FBgn0033542 Length:527 Species:Drosophila melanogaster


Alignment Length:289 Identity:75/289 - (25%)
Similarity:114/289 - (39%) Gaps:67/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEENGPAHWAKEYPQASG------HRQSPVDITPSSAKKGS--ELNVAPLKWKYVPEHTKS- 60
            :||..::||..|..:...:|.      ..||||:|..|..::.:  ||    |.|.:..:...| 
  Fly    83 YGYDMQHGPHTWLPKSRSSSSSVEEATFFQSPVNIDESQIQRMAIREL----LSWNHYDDLPASI 143

  Fly    61 -LVNPG--YCWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLV 122
             |.|.|  ...|...:|....::|..|......|| ...|||..:|:|||||::...:..|:.::
  Fly   144 TLENTGQTLILRAQFHGNAPTISGADLLASYTFLE-LRFHWGWCNSEGSEHTINHRKFPLEMQVM 207

  Fly   123 HWN--------TTKYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQ 179
            |..        |:.|           .|.::|...:...|:..||.:...|:.|...|.||    
  Fly   208 HKTGSGIPRTCTSSY-----------DLLMIGYVFELSAHNPFLDPLVQNLRLVQKPGKRV---- 257

  Fly   180 GCDPGQLLPDVHTY---------WTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYD 235
                 |:.|...:|         ::|.||||.|||.:...|.:|...:.:||.||...|.|...|
  Fly   258 -----QISPFPISYLMYQFRSGFYSYGGSLTHPPCYQGTEWFIFPESLAISDFQLRHFRLLLGPD 317

  Fly   236 VKEECPCNEFNG--KVINNFRPPLPLGKR 262
                       |  .:..|.||...:|.|
  Fly   318 -----------GISPIARNSRPVQHMGNR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 75/289 (26%)
CAH13NP_610602.2 alpha_CARP_receptor_like 90..339 CDD:239396 73/282 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446819
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.