DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and CARPA

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster


Alignment Length:277 Identity:86/277 - (31%)
Similarity:131/277 - (47%) Gaps:35/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEENGPAHWAKEYPQ----ASGHRQSPVDITPSSAKKGSELNVAP-LKWKYVPEHTKS--LV 62
            |.|...:||:.|....||    ..|.||||:|:.|      .:|...| |:..::.:|..|  |.
  Fly    39 WTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVP------DKLLFDPYLRPLHIDKHKVSGTLH 97

  Fly    63 NPG--YCWRVD------VNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGEL 119
            |.|  ..:|||      ||     ::||||..: ::.|:.:.|:|..:.:||||.:.|.|:.||:
  Fly    98 NTGQSLVFRVDKDTKQHVN-----ISGGPLAYR-YQFEEIYIHYGTENVRGSEHFIQGYSFPGEI 156

  Fly   120 HLVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAG-NHHAELDKVTSLLQFVLHKGDRVTLPQGCDP 183
            .:..:|...|.:..||.....|:..|.:.::.| ..:.||..:||....||::|....: :....
  Fly   157 QIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPI-RHISV 220

  Fly   184 GQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGK 248
            ..|||:...|.|||||.|.|.|.||.:||:...||.::..:|..:|.|  ....|..|    ...
  Fly   221 RSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRL--MQGSESTP----KAP 279

  Fly   249 VINNFRPPLPLGKRELR 265
            :.||.||...|..|.:|
  Fly   280 LGNNARPVQSLHHRTVR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 84/273 (31%)
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 84/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.