DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and Ca9

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001101426.1 Gene:Ca9 / 313495 RGDID:1306426 Length:437 Species:Rattus norvegicus


Alignment Length:271 Identity:91/271 - (33%)
Similarity:139/271 - (51%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEENGPAHWAKEYPQASGHRQSPVDI---TPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGY 66
            |.|   .|...|.:..|..:|..||||||   ..|..:....|.:...:.:.:||  .||.|   
  Rat   120 WSY---GGTLLWPQVSPACAGRFQSPVDIRLELTSFCRTLQPLELLGYELQSLPE--LSLCN--- 176

  Fly    67 CWRVDVNGADSELTGGP-----LG-DQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWN 125
                  ||...:||..|     || .|.::..|.|.|||.:|..||||||:|..:..|:|:||.:
  Rat   177 ------NGHTVQLTLPPGLKMVLGPGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPAEIHVVHLS 235

  Fly   126 TTKYKSFGEAAAAPDGLAVLGVFL-KAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLP- 188
            |. :....||...|.|||||..|| ::...::..:::.|.|:.:..:|.::.:| |.|...||| 
  Rat   236 TA-FSELHEALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEIAEEGSKIEIP-GLDVSALLPS 298

  Fly   189 DVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNF 253
            |:..|:.|||||||||||:.|||.||...:::|..||:.: :::.:.:::        .::..||
  Rat   299 DLSRYYRYEGSLTTPPCSQGVIWTVFNETVKLSAKQLHTL-SVSLWGLRD--------SRLQLNF 354

  Fly   254 RPPLPLGKREL 264
            |...||..|.:
  Rat   355 RATQPLNGRTI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 90/268 (34%)
Ca9NP_001101426.1 alpha_CA 128..370 CDD:294017 88/260 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.