DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and Ca11

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_783639.1 Gene:Ca11 / 308588 RGDID:735155 Length:328 Species:Rattus norvegicus


Alignment Length:290 Identity:85/290 - (29%)
Similarity:135/290 - (46%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEE------NGPAHW----AKEYPQASGHRQSPVDITPSSAKKGSELN-------VAPLKWK 52
            |.|.|.      .||..|    |.....|.|.||||||:         ||.       :.||:..
  Rat    35 WSYKENLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDV---------ELKRVLYDPFLPPLRLS 90

  Fly    53 YVPEHTK-SLVNPGY------CWRVDVNGADSELTGGPLGDQIF--KLEQFHCHWGCTDSKGSEH 108
            ...|..: :|.|.|.      ..|..||     ::||||   ::  :|.:....:|..|..||||
  Rat    91 TGGEKLRGTLYNTGRHVSFLPASRPVVN-----VSGGPL---LYSHRLSELRLLFGARDGAGSEH 147

  Fly   109 TVDGVSYSGELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLK-AGNHHAELDKVTS--LLQFVLH 170
            .::...:|.|:.|:|:|...|.:...|:..|:|||:|.:|:. ||:.:..|.::.:  .:..:.:
  Rat   148 QINHQGFSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISY 212

  Fly   171 KGDRVTLPQGCDPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYD 235
            |.|...| |......|.|:...:.||:|||:||||||:|.||:....:.::..|::::|.|:   
  Rat   213 KNDAYFL-QDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLS--- 273

  Fly   236 VKEECPCNEFNGKVINNFRPPLPLGKRELR 265
               :.|.::....:..|.||..||..|.||
  Rat   274 ---QNPPSQIFQSLSGNGRPLQPLAHRALR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 82/286 (29%)
Ca11NP_783639.1 alpha_CARP_X_XI_like 48..304 CDD:239395 82/277 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.