DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and Ca8

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001009662.1 Gene:Ca8 / 297814 RGDID:1304709 Length:290 Species:Rattus norvegicus


Alignment Length:269 Identity:101/269 - (37%)
Similarity:147/269 - (54%) Gaps:19/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCWR 69
            |||.|   ...|...:|.|:|..|||:::....|:....|....|...||......:.|.|:..:
  Rat    29 WGYEE---GVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQ 90

  Fly    70 VDVNGADSELTGGPLGD-QIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSFG 133
            | :..:.|.|:||||.. |.|:|.:...|||..:.:||||||:..::..||||:|||:|.:.|..
  Rat    91 V-ILKSKSVLSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSID 154

  Fly   134 EAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGC-DPGQLLPD--VHTYWT 195
            ||...|.|:.::.:|::.|..|..|..||.:||.:.:||...|:|  | :|..||||  :..||.
  Rat   155 EAVGKPHGIVIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIP--CFNPNTLLPDPLLRDYWV 217

  Fly   196 YEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAY----DVKEECPCNEFNGKVINNFRPP 256
            ||||||.|||||.|.||:|:.|:.:|..|:...|.|..:    ::.|.|     :|.:.:||||.
  Rat   218 YEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGC-----DGILGDNFRPT 277

  Fly   257 LPLGKRELR 265
            .||..|.:|
  Rat   278 QPLSDRVIR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 99/265 (37%)
Ca8NP_001009662.1 alpha_CARP_VIII 35..289 CDD:239394 97/260 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.