DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and cah-3

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001370788.1 Gene:cah-3 / 181713 WormBaseID:WBGene00000281 Length:246 Species:Caenorhabditis elegans


Alignment Length:279 Identity:92/279 - (32%)
Similarity:140/279 - (50%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHHWGYTEEN--GPAHWAKEYPQASGHRQSPVDITPSSA-KKGSELNVAPLKWKYVP-EH--TK 59
            |:.||.|.:::  ||..|      .:|..|||::|..... :|.:...:     |:|. :|  ..
 Worm     1 MTGHWSYCDDDECGPNRW------PTGQHQSPINIDLGEVERKDTHDGI-----KFVNYDHPIQG 54

  Fly    60 SLVNPGYCWRV--DVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLV 122
            .:||.|:..::  ::.....|:.||.| ||:::|.|:|.|||..|::|||||:.|:.|..|||||
 Worm    55 DIVNNGHSVQMTPELRSEHPEIYGGGL-DQVYRLVQYHFHWGENDNEGSEHTLGGLRYPAELHLV 118

  Fly   123 HWNTTKYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHK---GDRVTLPQGCDPG 184
            |          :....|..|||:||||:.|..    .|..|..:.||.|   .:.||..:.....
 Worm   119 H----------QGVEDPGKLAVVGVFLQLGKE----GKALSNEERVLGKLCNPETVTRVENVRLS 169

  Fly   185 QLLP-DVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGK 248
            :.|| :..::|.||||||||||||.|.|.:|..|:.|:.|||...|.:.  |:::.        .
 Worm   170 EKLPANKRSFWRYEGSLTTPPCSEIVTWTIFTEPVTVTHDQLELFRQVQ--DIEKR--------P 224

  Fly   249 VINNFRPPLPLGKRELREI 267
            :..|:||...|..|::..|
 Worm   225 IKKNYRPTQNLNDRKIVHI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 88/269 (33%)
cah-3NP_001370788.1 Carb_anhydrase 5..239 CDD:215000 88/269 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55875
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4132
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm14370
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.680

Return to query results.
Submit another query.