DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and cah-4

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_510265.1 Gene:cah-4 / 181478 WormBaseID:WBGene00000282 Length:280 Species:Caenorhabditis elegans


Alignment Length:236 Identity:91/236 - (38%)
Similarity:118/236 - (50%) Gaps:41/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KEYPQASGHRQSPVDITP------SSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCWRVDVN--- 73
            |::.:|:..||||:||.|      :...|...||:          ..||    |.|..|.|:   
 Worm    42 KKFKKAAAQRQSPIDIVPQHVCCDTDVCKADALNI----------DYKS----GDCCDVLVSEGG 92

  Fly    74 -------GADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKS 131
                   ...:.||...|....|.|.|||.|||....:||||.:||...|||:|.|.|||: |:|
 Worm    93 FLVNVKRNCGTFLTANHLPSSKFALAQFHAHWGSNSKEGSEHFLDGKQLSGEVHFVFWNTS-YES 156

  Fly   132 FGEAAAAPDGLAVLGVFLKAG----NHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLL--PDV 190
            |..|.:.||||||:|||||.|    |:|..:|.|..    .......:.:|:......||  ||.
 Worm   157 FNVALSKPDGLAVVGVFLKEGKYNDNYHGLIDTVRK----ATGNATPIAMPKDFHIEHLLPSPDK 217

  Fly   191 HTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNL 231
            ..:.||.|||||||.:|.|||.:|..|:|||..|||.:||:
 Worm   218 REFVTYLGSLTTPPYNECVIWTLFTEPVEVSFGQLNVLRNI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 91/236 (39%)
cah-4NP_510265.1 alpha_CA 50..275 CDD:238200 89/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I2976
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I3082
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm14370
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2434
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.