DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and cah-5

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_509186.3 Gene:cah-5 / 180972 WormBaseID:WBGene00000283 Length:310 Species:Caenorhabditis elegans


Alignment Length:283 Identity:93/283 - (32%)
Similarity:134/283 - (47%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HHWGYTEENGPAHWAKEYPQASGH-RQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGY 66
            |.|||.|.|||..|   ..:...| :|||:||      :..:::.|.|       |....:|...
 Worm    26 HGWGYDENNGPDTW---QGKCQNHLKQSPIDI------RAPDVDYALL-------HRMHFLNYDM 74

  Fly    67 CWRVDVNGADSEL---------------TGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYS 116
            ..:::::.....|               .||.|..: :||.|||.|||..|:.||||.:..:.|.
 Worm    75 DGKIELSNTGRTLFAGGFESWQHKQPMIQGGGLKHR-YKLAQFHLHWGQNDAVGSEHAMGSLHYP 138

  Fly   117 GELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAGNHHA--ELDKVTSLLQFVLHKGDRVTLPQ 179
            .||||||  ..:..:..||.:.||||||:||||...|...  :...::..|..:.|.|::..| :
 Worm   139 AELHLVH--VREGLTLKEALSRPDGLAVVGVFLAKTNDPVANKFSPISERLHDLRHSGNKTEL-K 200

  Fly   180 GCDPGQLLP-DVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNL-NAYDVKEECPC 242
            ......:|| |...::.||||||||.|||:|||.|...|:.:|..||:.:|.| |...||.:   
 Worm   201 NFRTKYVLPLDTEAFYRYEGSLTTPDCSEAVIWTVLAEPMAISSHQLHLLRQLHNKELVKSD--- 262

  Fly   243 NEFNGKVINNFRPPLPLGKRELR 265
                    .|:||..||..|.::
 Worm   263 --------KNYRPLQPLNGRRIQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 91/277 (33%)
cah-5NP_509186.3 Carb_anhydrase 28..275 CDD:215000 91/277 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55875
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm14370
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2434
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.