DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and Car11

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006540651.1 Gene:Car11 / 12348 MGIID:1336193 Length:344 Species:Mus musculus


Alignment Length:290 Identity:85/290 - (29%)
Similarity:135/290 - (46%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEE------NGPAHW----AKEYPQASGHRQSPVDITPSSAKKGSELN-------VAPLKWK 52
            |.|.|.      .||..|    |.....|.|.||||||:         ||.       :.||:..
Mouse    35 WSYKENLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDV---------ELKRVLYDPFLPPLRLS 90

  Fly    53 YVPEHTK-SLVNPGY------CWRVDVNGADSELTGGPLGDQIF--KLEQFHCHWGCTDSKGSEH 108
            ...|..: :|.|.|.      ..|..||     ::||||   ::  :|.:....:|..|..||||
Mouse    91 TGGEKLRGTLYNTGRHVSFLPASRPVVN-----VSGGPL---LYSHRLSELRLLFGARDGAGSEH 147

  Fly   109 TVDGVSYSGELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLK-AGNHHAELDKVTS--LLQFVLH 170
            .::...:|.|:.|:|:|...|.:...|:..|:|||:|.:|:. ||:.:..|.::.:  .:..:.:
Mouse   148 QINHEGFSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISY 212

  Fly   171 KGDRVTLPQGCDPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYD 235
            |.|...| |......|.|:...:.||:|||:||||||:|.||:....:.::..|::::|.|:   
Mouse   213 KNDAYFL-QDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLS--- 273

  Fly   236 VKEECPCNEFNGKVINNFRPPLPLGKRELR 265
               :.|.::....:..|.||..||..|.||
Mouse   274 ---QNPPSQIFQSLSGNGRPLQPLAHRALR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 82/286 (29%)
Car11XP_006540651.1 alpha_CARP_X_XI_like 48..304 CDD:239395 82/277 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.