DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca3

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002939197.2 Gene:ca3 / 100496328 XenbaseID:XB-GENE-1007186 Length:262 Species:Xenopus tropicalis


Alignment Length:266 Identity:103/266 - (38%)
Similarity:144/266 - (54%) Gaps:15/266 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HHWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYC 67
            |.|||...|||..||:.:|.|.|.:|||:::.....|....|.  |....|.|..:.::||.|..
 Frog     5 HDWGYASHNGPDTWAEYFPAAKGDQQSPIELLTRYIKHDPTLR--PWTSTYHPSTSLTVVNDGTT 67

  Fly    68 WRV--DVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYK 130
            .||  |.:...|.:..||: :..::|.|...|||.:|..||||.:||..|:||:|.:||| :||.
 Frog    68 CRVVFDDSTDKSVIKDGPM-NGTYRLRQLQFHWGSSDDHGSEHVIDGFRYAGEMHFIHWN-SKYD 130

  Fly   131 SFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHTYWT 195
            :..||...|||:|::.||||.|.....|..|...|..:.:||.:..... .||..|.|....|||
 Frog   131 NITEAKKHPDGVAIIAVFLKIGKAKPHLKLVLEALDCIKNKGKKAHFTD-FDPTILFPSSRDYWT 194

  Fly   196 YEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKE-ECPCNEFNGKVINNFRPPLPL 259
            |:||.|||||.|.|.|::...||.||.:|:...|::  |...| |..|:     :::|||||.|:
 Frog   195 YQGSFTTPPCEECVTWLLLSEPITVSPEQMEKFRSV--YSTLEGEIECH-----MVDNFRPPQPV 252

  Fly   260 GKRELR 265
            ..||:|
 Frog   253 KGREIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 99/260 (38%)
ca3XP_002939197.2 alpha_CA 4..261 CDD:412109 103/266 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2444
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3370
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm49425
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2434
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.200

Return to query results.
Submit another query.