DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and LOC100496280

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002940642.4 Gene:LOC100496280 / 100496280 -ID:- Length:313 Species:Xenopus tropicalis


Alignment Length:257 Identity:84/257 - (32%)
Similarity:127/257 - (49%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WGYTEEN-GPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLV--NPGY 66
            |.||:.. ||:.|..: ...:|.||||::|..:|.:..:.|..  ..:....:.:|.::  |||:
 Frog    21 WCYTDPACGPSTWVTQ-GFCNGSRQSPINIVDASVQYNASLGT--FTFTNYGDSSKLVLLNNPGH 82

  Fly    67 CWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKS 131
            ...|.: .:...|:||.| ...:....||.|||.|...||||.:.|..:..|:|:||  |....:
 Frog    83 TVEVQL-ASGVTLSGGGL-PSTYSAVAFHFHWGNTSQNGSEHQLGGRQFPMEMHIVH--TKNGMN 143

  Fly   132 FGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLL--PDVHTYW 194
            ...|...|:|:||||.|:..|...::|..:.|||..|.:.|..:||........:|  .|..:|:
 Frog   144 LTAAKQDPNGIAVLGFFIDVGTSSSKLPTLASLLVNVSNAGTNITLNGSFSIDSILGAVDRTSYY 208

  Fly   195 TYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNL--NAYDVKEECPCNEFNGKVINNFR 254
            .|.||||||.|.|:|:|.||:.||.|   ..:.::|.  |.|......|.|     ::||||
 Frog   209 RYLGSLTTPTCDEAVVWTVFRNPILV---PASVIQNFSSNIYLNSTGSPQN-----MVNNFR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 84/257 (33%)
LOC100496280XP_002940642.4 alpha_CA 41..272 CDD:412109 78/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.