DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and Car10

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_017453181.1 Gene:Car10 / 100360015 RGDID:2322930 Length:328 Species:Rattus norvegicus


Alignment Length:306 Identity:89/306 - (29%)
Similarity:141/306 - (46%) Gaps:78/306 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EENGP----AHWA-KEYPQAS--------------------GHRQSPVDI-----------TPSS 37
            ::|.|    ..|| ||..|.|                    |.|||||:|           ||..
  Rat    22 QQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLR 86

  Fly    38 AKKGSELNVAPLKWKYVPEHTKSLVNPG--YCWRVD----VNGADSELTGGPLGDQIFKLEQFHC 96
            ...|..            :.:.::.|.|  ...|:|    ||     ::|||: ....:||:...
  Rat    87 INTGGR------------KVSGTMYNTGRHVSLRLDKEHLVN-----ISGGPM-TYSHRLEEIRL 133

  Fly    97 HWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAG-------NH 154
            |:|..||:||||.::|.::|||:.|:|:|...|.:..|||.:|:||.|:.:|:|..       |.
  Rat   134 HFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNR 198

  Fly   155 HAELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIE 219
            ....|.:|.    :.:|.|...| ||.:..:|.|:..::.||:||:|.|||.|:..||:...|:.
  Rat   199 MLNRDTITR----ITYKNDAYLL-QGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVY 258

  Fly   220 VSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPLPLGKRELR 265
            ::..|::::|.|:     :..|...|. .:.:||||..||..|.:|
  Rat   259 ITRMQMHSLRLLS-----QNQPSQIFL-SMSDNFRPVQPLNNRCIR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 87/302 (29%)
Car10XP_017453181.1 alpha_CARP_X_XI_like 46..302 CDD:239395 81/282 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.