DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH1 and ca6

DIOPT Version :9

Sequence 1:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_009295179.1 Gene:ca6 / 100006448 ZFINID:ZDB-GENE-030131-7091 Length:538 Species:Danio rerio


Alignment Length:280 Identity:94/280 - (33%)
Similarity:136/280 - (48%) Gaps:51/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCW 68
            :|.|:.|....|||::|....|.:|||:||...             |.:|.| ..:.|...||  
Zfish    25 YWTYSGELDQKHWAEKYHDCGGQQQSPIDIQRR-------------KVRYSP-RMQQLELTGY-- 73

  Fly    69 RVDVNGADSELTGG-------PLGDQIFK-------LEQFHCHWGCTD--SKGSEHTVDGVSYSG 117
             .|:.|:......|       |...:|.|       ..|.|.|||..|  :.|||||:||:.|..
Zfish    74 -EDIRGSFLMKNNGHSVEIQLPSTMKITKGFPHQYTAVQMHLHWGGWDLEASGSEHTMDGIRYMA 137

  Fly   118 ELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAGNHHAE----LDKVTSLLQFVLHKGDRVTLP 178
            |||:||:|:.||.||.||...|||||||..|.:.|  |.|    .|.:::|.. :.:.|..:::.
Zfish   138 ELHVVHYNSEKYPSFEEAKNKPDGLAVLAFFFEDG--HFENTYYSDFISNLAN-IKYVGQSMSIS 199

  Fly   179 QGCDPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRN-LNAYDVKEECPC 242
            .......|..::..::.|:||||||||.|||:|.||.|||.:|.:|:..:.: |..:|       
Zfish   200 NLNVLSMLSENLSHFYRYKGSLTTPPCFESVMWTVFDTPITLSHNQIRKLESTLMDHD------- 257

  Fly   243 NEFNGKVINNFRPPLPLGKR 262
               |..:.|::|...||.:|
Zfish   258 ---NKTLWNDYRMAQPLNER 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 94/279 (34%)
ca6XP_009295179.1 alpha_CA 33..281 CDD:320708 91/272 (33%)
LamG 332..521 CDD:328935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.