DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec71 and CYTH3

DIOPT Version :9

Sequence 1:NP_609675.2 Gene:Sec71 / 34785 FlyBaseID:FBgn0028538 Length:1653 Species:Drosophila melanogaster
Sequence 2:NP_004218.1 Gene:CYTH3 / 9265 HGNCID:9504 Length:399 Species:Homo sapiens


Alignment Length:202 Identity:97/202 - (48%)
Similarity:139/202 - (68%) Gaps:5/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 ALEERK--MRKEVMETGIELFNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIG 637
            ::||.|  .|.:.:..|.:.||..|:||:|||.|..||.::..|:|::|::.|.|:|||||:|:|
Human    57 SVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLG 121

  Fly   638 ENDDHSKEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLF 702
            |.|:.:.:|:.|:::..:|..:.:|.|||..|..||||||||||||:||.||||||.|||  .:|
Human   122 ERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNP--GVF 184

  Fly   703 QSADTVYVLAFSIIMLTTDLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEISEHEI 767
            ||.||.|||:|:||||.|.||:..|:.|.|.|::|.|||||::. .|||||.|.::|:.|.....
Human   185 QSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEG-GDLPEELLRNLYESIKNEPF 248

  Fly   768 KMKNNSG 774
            |:..:.|
Human   249 KIPEDDG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec71NP_609675.2 PLN03076 13..1580 CDD:215560 97/202 (48%)
DCB 30..212 CDD:292830
Sec7_N 312..465 CDD:289549
Sec7 582..767 CDD:279680 92/184 (50%)
DUF1981 1080..1161 CDD:286414
CYTH3NP_004218.1 Sec7 66..248 CDD:396096 92/184 (50%)
PH_GRP1-like 263..382 CDD:269954
C-terminal autoinhibitory region. /evidence=ECO:0000269|PubMed:23940353 391..399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148858
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.